PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g04060.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 408aa    MW: 45097.9 Da    PI: 9.7762
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g04060.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.2e-19148195148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WTt+Ed+ll++ v+q+G g+W+++ ++ g++R++k+c++rw +yl
  Zjn_sc00004.1.g04060.1.am.mk 148 KGPWTTQEDKLLIEHVRQHGEGRWNSVCKHTGLKRSGKSCRLRWVNYL 195
                                   79********************************************97 PP

2Myb_DNA-binding53.65.1e-17201245147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  Zjn_sc00004.1.g04060.1.am.mk 201 RGKITPQEERIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 245
                                   8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.015143195IPR017930Myb domain
SuperFamilySSF466896.24E-29146242IPR009057Homeodomain-like
SMARTSM007172.3E-16147197IPR001005SANT/Myb domain
PfamPF002491.2E-17148195IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-23149202IPR009057Homeodomain-like
CDDcd001671.33E-12150195No hitNo description
PROSITE profilePS5129426.063196250IPR017930Myb domain
SMARTSM007172.8E-16200248IPR001005SANT/Myb domain
PfamPF002491.2E-14201245IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-24203248IPR009057Homeodomain-like
CDDcd001672.83E-11205246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
LACGREKQGR EDLFNRVPAP AGRTFVALMM RGVAIRLDRQ RTYGLANRRG GRIGAGACAL  60
YARVGYVEAR VRDVPVLRSR SPSGNFMSRD ARTGTSGDSD HLTRLRTCPS DQDTRYRSRA  120
SMREPRCAAI TMEGQLSWGR QEVDGWRKGP WTTQEDKLLI EHVRQHGEGR WNSVCKHTGL  180
KRSGKSCRLR WVNYLRPDLK RGKITPQEER IIVQLHALWG NRWSTIARSL PGRTDNEIKN  240
YWRTHFKKGK PSKNIEIARA RFLKQRREMQ CPQQQQQVQL VNKNEDTELH ATRTAGTVKV  300
DADRGSAVVD NACPATTTAA AAAAADQSGH QQAADLIIHD VIMDFMCPMS CSLLLHGAGA  360
HQGAAGAGSC CGSTSEEYGS SEEDGATWGS LWNLEDIVVD GGGGACSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-2714824827126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-123AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-117PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-117K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-117(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.14e-62myb domain protein 79